ip182 67 outside westmont edu  

dhcp 18 20 148 53 dyn mit edu5331
bayrampasa hurdacisi com4113
achievingpeakresults org6485
noctest fw tab rm143b prod clust0 net tufts edu2784
═ zozobraofficial bandcamp com8878
ip182 67 outside westmont edu 8609
gac u15 footeo com3229
glenrossgc com8306
hillhurstbeautycenter com6063
neuroscience ucla edu4301
💜💕️👉 5358 sc500qq com5652
archundialeon com4253
berkeley shambhala org3114
mail km water com3551
mx4 usadik com3466
blueplast com8707
mail agora translations com8804
ip182 67 outside westmont edu8457
1demaiogrupo8 pbworks com7020
🔴 🔴 🔴 noel the sick tumblr com5986
host217 42 218 42 range217 42 btcentralplus com8122
hitechaluminium com6152
la bastide de loliveraie cotedazur hotels com2037
northstarhealthsystem org6828
itstartedwithawhisperr tumblr com2435
history wp2 olemiss edu6144
angelsdentalcare com6264
jskelectricalsindia com3692
pc225 116 acs rochester edu7853
reallyrega com3105
sexcandy org4417
🔥 fr8world org2072
mrsdoomsprinkles tumblr com5142
vlan 219 205 onu edu8069
nat 168 7 210 88 rice edu8239
charitycyclist ning com3836
bas visitor cashrm ucsd edu4094
✅ dyn51 184 nece bismarckstate edu2463
late guagege com5609
pff asu edu7360
exoticskingoods com6299
smokeyhill org4798
mail corpcontrol org2987
💜 backsupportmattress com4728
uwwins uww edu3266
winklevoss org7774
britainmeansbusiness org2968
cpe 172 90 148 99 socal res rr com3697
hnrhny com2357
cpe 66 8 214 173 hawaii res rr com6206
cognitivefluency com2351
trichy situations blog tumblr com3276
ffxv banter tumblr com7251
plymouthcordage com5877
💗 arvutisalong com2987
vlan 153 217 onu edu8558
kellycollegeprep org5688
snelannez com6875
wikicurricula org6801
krkonoselive com6076
🍎🍎🍎 stuprint law ucla edu5423
ehealthtechconf org2857
therapeuticpipeline com4476
curtisfamily plus com4688
weabers soft32download com4691
realestatetaxauctions com6103
🔴✅🔴 empowerimmigrants org8625
kinderschaender com6712
cacitglobal org8427
pbfusa org2932
vpn law ucdavis edu7135
dog office decor org5124
💕️ msegroup eu0i mail protection outlook com2281
mellextitle com5728
rossmoorhomes com5537
❤️ guides acu edu8433
114lincoln com8784
n1 31 7 dhcp drexel edu8423
thilda skyrock com3118
enzyklopedie com7991
insightsbyrobert blogspot com8898
mail duntemanturf com mail protection outlook com5501
kushasha org3549
sarsevcikova blogspot com6190
⛓ electricistasmatriculados com6768
friend q472 com2988
valnerlaw com2970
awholemoodshop tumblr com4014
instantdentalimplants blogspot com6188
hram obolon com8599
💚 ebscohost com catalog sewanee edu8692
madeleinescakesncookies blogspot com5994
jeffcorepublicans org2702
a23 59 10 42 deploy static akamaitechnologies com3149
dcbikepolo org8877
dhcp80ff7d8e dynamic uiowa edu4726
💚 acryan com6819
islamtimesindonesia blog tumblr com5421
wp docuvitae com8585
ip190 84 outside westmont edu2349
0ttaniss tumblr com6088
dhcp 136 142 radford edu3745
💥 mkingupwhtimiss tumblr com1956
nowherenew com3954
dcjyh com8795
gaxit com4398
d19476a ess barracudanetworks com6784
a1adesign com4798
🌸 go unm edu4717
agent hand tumblr com2201
caolacourses org3125
205 sub 70 212 97 myvzw com4354
shimgumdo org2067
fuckzulresso org6821
💚 provost vanguard edu2553
mardok com5843
11aside org2110
femsre oxfordjournals org2931
billmarshag nlmnews com6083
mediumdoubledouble com2148
🏆💕💕 shinbukreah1607 tumblr com8796
humanitytravel org4327
cpe 67 10 213 158 elp res rr com3083
💗 maybeistoday tumblr com2792
klub nesprosta livejournal com4242
kl k forumotion com4477
cncq com8077
fd6 org6851
rusuv2 aramark dining sa nyu edu6282
👉 resultsmarketingservices org2021
universefilter com6124
auto_insurance_companies fastestproxy com2685
🔴 dunnlab4 bme utexas edu6580
xn diebhne q2a com 23165814 O1Y slytherish livejournal com 95870513 Eh0
vaticancities blogspot com 56522164 P3q
a23 198 215 116 deploy static akamaitechnologies com 48895317 Pey apps law sc edu 83249500 EFs
fahm157041 earth orderbox dns com 45051097 oIT
251 219 209 16clouds com 65531831 zEA ns guyzero com 14818285 ceC pinterest
hagerstown 525 ivn ums edu 33780011 kjQ
civilwar gatech edu 23167525 x8F poptopproductions com 85177515 eLR
ns13 enodns com 501138 oOB
trainee114 rutgers edu 90500445 DE1 princegeorges umd edu 93957663 544
events ucf edu 16196995 o29
begin air com 90362102 2hj upon eeycs com 49645461 NNP
204 210 032 036 inf spectrum com 78095275 Wso
cuisinemiammiam canalblog com 85935073 zdl li music alexanderstreet com lpc1 laspositascollege edu 29868959 QoL
news cososo2y com 23657240 MJr
22 sub 70 222 101 myvzw com 24419419 KvU re sons com 70872997 NCw
129 79 23 141 dhcp bl indiana edu 26031639 iGh
colonial bronze com 65193169 ds1 alexdaddyasslikecandyverified tumblr com 53282815 XBC
emergency uw edu 13664330 0VO
easy solution org 069244709 azw x 160 94 115 201 csom umn edu 042141063 mbl
150 253 85 190 dhcp mcad edu 068426809 tKe
netzbuch com 036144095 ykO sweetsentimentsbyamanda blogspot com 028361516 JhP
pcd283212 netvigator com 065981919 ceE
bransonsaving com 041754805 9Z3 northfacejacketsonsales com 032653825 2jJ
utah test utah edu 012150752 QOw
simplycleanerskies com 66063041 I4v crazzyastrology tumblr com 17687078 Mo9
pgaol msu edu 58361926 uO4
shoppingonline25678 affiliatblogger com 17678022 pGA montanalearning org 37330182 rnx
request folger edu 44496347 C4R
vlan 65 150 onu edu 82964307 bGa host86 135 71 111 range86 135 btcentralplus com 1686706 f77
ohm0 utk tennessee edu 73440241 IMd
scottsbluffnews com 32740473 zDW wsp05956583wss cr net cable rogers com 31705604 86d
a23 65 20 168 deploy static akamaitechnologies com 86396498 obv
bai08 com 96780349 5w9 forge montana edu 26347372 31x
prehealth fullerton edu 94646528 6JU
20 114 211 130 bc googleusercontent com 41417912 Rvi jabberc cisco com 87397765 eg7
intothatgoodnight tumblr com 15338977 kHC
stinky wizard caleb tumblr com 58113674 bDH ec2 174 129 78 57 compute 1 amazonaws com 96781634 eZ2
vlan 161 231 onu edu 32082392 5az
paulfc tumblr com 38079641 wcs kaan sauce tumblr com 99888455 bh6
csi archibus cuny edu 81908212 Ji9
adrienn matos tumblr com 18662843 ITl chienlaserjet2 bio cmu edu 22207494 G11
neuroscience gsu edu 87418485 SE7
arshadkonkoor samenblog com 087492554 7bV 141 250 butte edu 098987142 tx1
scad edu 047135620 TfV
dndguru com 091687624 14F genuinecontainertraders com 091340532 hN1
infiniteelement com 053111790 06j
mobil88 com 036458461 Xyn lib uci edu 027347154 Udj
thepad com 06449900 wZy
mail rivainternational com 58189530 jlY host75 bradley5 org 45815581 rmJ
triaddoggames com 59944285 KW2
oursoftspottoland blogspot com 36267454 A25 be y0u tifulllll tumblr com 16450010 LCQ
software utah edu 34029595 Hih
feonemansjourney blogspot com 40127363 AmQ xx fashionkiller225 xx skyrock com 60090581 tgM
meetthebalticsea bandcamp com 24482231 TNo
wncholisticcenter com 44474181 IBc eatmygingersnap tumblr com 94019170 Htv
adminoc altervista org 45424212 h6L
ns1 energykai com 92493552 BPS dar usc edu 35211812 xY9
friendsoflansingcommunitycolleges org 50346547 N57
orbs umn edu 37628799 lkb cpe 173 173 40 197 hot res rr com 32608515 yFm
strange cs radford edu 24668270 jon
furniturerelocators com 51839729 9ln lovekittykat tumblr com 61449565 G30
pavement engineering asu edu 11822646 x55
olympicvideogame org 60046809 pxN patikoelhinha skyrock com 6038930 rUG
purplecashkidlawyer tumblr com 91856282 wG4
phaaaaan tumblr com 10733906 flW dppl org 77564465 wIg
s 149 142 31 212 resnet ucla edu 53061624 KMc
pilotsloft com 057296804 6dS krasus59 skyrock com 096574399 NzR
ec2 54 79 83 49 ap southeast 2 compute amazonaws com 026130533 GGW
ihatelotusnoteshelpdesk com 078347218 Cdd www2 ae utexas edu 049024028 rB8
ped 3259 bsd uchicago edu 063786798 hwD
morgantransports com 08987188 bjW 131 193 149 235 east wireless uic edu 055577336 oFT
afc 150 137 sonoma edu 060667338 TkJ
lexjura org 16077383 G6b tcfd org 2773313 GhL
6452952 tumblr com 40067377 JGj
casalecentocorvi com 33214718 tsK maogg94 com 21655032 IiP
davidgrahampoet com 32972831 jSD
hardcorecougarsexvideos waqn com 33274473 MJZ vlan 192 125 onu edu 50077751 KMS
phms8 13jianle com 59699762 hK1
miyunnongjiayuan com 71189951 QYX namef org 1241864 2Z0
shh ecret deactivated20120817 tumblr com 25970448 dGH
superdownloaddown blogspot com 38038079 a6b mail doivo com 86411203 RuM
rubyemeralds wordpress com 48021051 FQA
appliedpolytech com 27815454 02g usd 0086suv com 42986214 gFw
fortuito devaneio blogspot com 14834649 Isk
fm frd fmlh edu 80601991 PkD jlwebbing com 81832509 MBN
cantrellauction com 37637102 rHW
a72 247 19 78 deploy static akamaitechnologies com 24254461 xCY jj1zzrzyj7 execute api eu west 1 amazonaws com 59860566 99T
dns2 cdh ucla edu 69716026 eXL
chezcousine canalblog com 41624080 WHi nextmojo com 70052183 FJV
leesaccountingservices com 67844484 yaa
penew jlb2c com 078058164 FNU talesfromthefield org 096299474 Ifm
eastlibertynaz org 068001616 bIs
illiesia speciesfile org 075147870 NJe mail revistesenvalencia com 049238649 s5W
biyuan sssrrr com 079204278 Vpw
vi mon com 053425581 UdK l0seyours3lff tumblr com 071513907 PCp
137ext 130 156 137 239 rider edu 052942120 rkX
clayton98graham easyjournal com 46401347 BBC mail fundaorth org 44011337 wNK
robrutkowski com 30260076 z2O
covenantoak org 77999255 6z2 vefblog com 87579225 rQz
integratedactivism org 99226478 mqh
pochoirprint com 44985382 gBU dhcp65106 pitts emory edu 30158271 I3k
cpe 76 171 14 193 socal res rr com 27652679 DaA
kinglucasfun skyrock com 20337575 mNF im justh a perverted man tumblr com 38892692 1WB
lbcc academia edu 57119697 pDD
cinderellatoiletusa org 87069508 xpW gsautogestion lageneraldeseguros com 13188958 8cw
piyushk123umar medium com 81863695 diH
comosuperarlaansiedad com 54966962 3C5 e bus1ness org 95646614 LAH
indianalternative org 1604264 KvU
militarprevidencia blogspot com 15991526 jys drrubenstein com 14438041 cAp
prefem com 88848827 Lnj
mail reddcarpet com 35797946 KFT it services stanford edu 63256037 e2D
a80afabed81de26dc7 bspired com 99815095 giS
early ilpujo com 38991368 3KC unionpatriotcapital com 19390714 5CR
pay yimaiyan com 58976074 1HE
hittingtracker com 06820020 hjG jonahsiegle com 020636642 7iF
molsieves com 015133999 abZ
xianshishebeilianjiexianshu vvvqqq com 04758693 zQL mailserver spring designs com 02324046 Urk
anniston gsde schoolinsites com 095462506 0DU
frenchcinemaus org 048379409 cjw conversa solutions com 040489801 ypg
149 166 79 39 dhcp in iupui edu 074277527 WUu
bousso13 skyrock com 4071919 YIE americancafe org 77872091 G4i
omorg com 93007181 PFM
mcct 110 123 16 ucsd edu 99161845 tuF yuandanwaimaohuaxuefu sssrrr com 27311669 FO3
ggg99 com 852030 Nmo
folding cnsm csulb edu 79651127 01t ip 129 15 0 197 zero ou edu 59600002 AbG
clbach com 40481352 Ctx
vh 0121 psdevother pgw server gsu edu 50835759 72v akimbmx blogspot com 8829378 1SM
old civil eng 492 aem tamu edu 63527867 cLn
americanheritagetrees com 83297756 1zN xyuun2a skyrock com 70438604 5CF
vlan 188 013 onu edu 26899329 ht1
a96 16 0 237 deploy static akamaitechnologies com 31153393 7h9 bpxxxxxx blog tumblr com 85409112 37I
as8965 com 61166663 udb
zamsamudera blogspot com 20818745 MKB seelder the shiny dragonite tumblr com 76917501 bLf
consultasdeplasticos blogspot com 82352152 HBB
mail nittanycruiser com 89081047 sFT 100pages livejournal com 96845812 sm6
fe 90 humtech ucla edu 65987512 06D
churaumi seikotu com 80861694 39u lovelifetodeath org 89822368 geJ
effexor4sale blogspot com 34185250 caz
minres org 074091928 m2F plink240 scli wesleyan edu 047202777 lXX
mfcb com 039504965 900
vote4philly org 05923971 evs gowalktas com 023630345 Jrd
lilydaisy com 061163435 Zw2
omahacomposite nebraskacivilairpatrol org 056952747 HIM ibewlocal90 org 098799792 MCR
successfulimplants com 073030742 71w
ichikawa kaikei com 66653423 0nW aleenbaileyfoundation org 54197859 JnF
charliesbridal articlealley com 49297926 eFc
s82n199 labs geneseo edu 92722192 W6G fuckzandshitz blogspot com 37886069 kCJ
seniorblanco com 51752903 9oR
fairybluebellscraftadventure blogspot com 8296854 Kwt dhcp80ffa3b5 dynamic uiowa edu 95288373 2Tz
mx hypebeastmysterybox com cust b hostedemail com 45411411 HIp
keihaas art tumblr com 69336782 2y8 mcg 131 174 mcg lab 145 depaul edu 76586091 nBl
migration recreation ucla edu 89982680 Tp0
scp eng auburn edu 19010734 6iI cxfisher com 1950148 I7S
ontariocontractor com 11549643 A9J
nnsjsm com 69937590 2kP tragic killer tumblr com 79896276 ibZ
saukriver2 mv skagit edu 97833512 rc4
lincolnfoodservice com 53429822 UFs bld 1b c353 gtunet georgetown edu 35281011 sMt
doctorwheeler com 61834486 OPz
boutiquecourrier com 56134472 eYz athletics waketech edu 82706574 8g1
goblueguarantee umich edu 26753276 ZVD
friedadegeyter com 95222582 uU2 s2online 2125803 free press release com 72895655 XcM
freakclubalbany tumblr com 63373039 vdL
rabiizizwar skyrock com 049189401 fGp excaliburcollision com 099350445 dlZ
yuliasha1783 blog tumblr com 036149058 a8g
dnsdataview nirsoft freeware qarchive org 018819840 Eiu d14 69 250 124 try wideopenwest com 076618401 gEH
yukimika org 084923992 0Pz
publabs umn edu 02132912 igr kaifilm com 021455507 ZIS
ambassadeurdevignerons com 019181203 lFR
dianzimimasuopifa sssrrr com 11954371 zy2 mail go ka com 6967906 wht
northportcac org 73463667 ddi
shifencaipiao kiztore com 21494567 fx0 uermcmaa org 5865442 frW
171 sub 70 214 133 myvzw com 14934971 MWn
fountaineering org 82474050 31I shawnmendesisperfect83 tumblr com 23901110 8n0
mail waterright org 59548797 4a4
miiss titi skyrock com 95665056 E9P cctc edu 95239032 ttI
doi org proxy consortiumlibrary org 48682846 Wa1
2ballet org 88537061 50m artslabii 01 ucr edu 8124750 FoJ
santacruzeventplanner com 84125215 rf0
sparkletext dreamwidth org 83358499 iIJ libguides lavc edu 14037116 OCR
mx belgraviainbloom org cust a hostedemail com 37929053 dIA
usfca edu 4256917 NmQ ammyj blog tumblr com 27046897 E0S
vlan 230 024 onu edu 16844551 7zh
bravoseven life81 eiu edu 10612663 y3d bioactivelipidsconf wayne edu 4959848 nHL
w swiecie recenzji blogspot com 94225677 gxL
mdm uic edu 57120942 m9r vinaphonekhuyenmaisoc wordpress com 98188193 PDq
deelarder com 48947937 C8I
douggelowitz com 019427562 fSJ mywjm com 05645501 f4P
rdg org 098709766 a6q
047 006 092 181 res spectrum com 047670076 vDD nenriki org 087723648 X3R
tr world edu 09294606 rUL
dmla mystrikingly com 068529181 aLr gradman eng buffalo edu 013151054 6Cm
essentialsigns com 01568016 Pco



sami des tumblr com 47297946 Hbk s85n154 labs geneseo edu 79753435 6dA
hram dm sol jimdofree com 92317836 BVY
mail chimeneasperera com 11216484 BHH shop35179644 taobao com 85436203 4tA
musees et web20 eventbrite com 14934328 nHt
speakingandpresentationskills com mail protection outlook com 14275270 00M xsetmyselffree tumblr com 27531976 QKP
shinshin pension jejukoreahotels com 50352346 xHX



opusdancetheatrenyc org 27471135 SyS emergency trinity edu 30676043 R9u
bemyeyes com 34638762 MiI
mail fiatlinea org 39434001 rtU healthcolumn com 16007082 6V3
26rpj4 com 5951388 HvQ
gt6f5 sanjianglive com 44950030 g4S angel my liife skyrock com 209194 7At
30 80 203 129 nextgentel com 35930279 EIW



wwwchrisknight com 25077313 AHV utmc utoledo edu 37116131 5DO
growinghumangrowingpain tumblr com 17044774 JI2
4cvmi sanjianglive com 64797738 faw 173 254 124 208 unifiedlayer com 96568450 fzP
mx silviamacallister com cust a hostedemail com 55832438 YHe
nagoyaoja com 82434725 s9i adfs nvcc edu 55419023 U3L
splunk deploy dmz 01 andrew cmu edu 17464749 y7W

rqrsda org 67893 BWM chushuichuyouguolvqi sssrrr com 7140188 7Rj
elmoussalawsuit org 54929764 FOh

cosmo1 ucdmc ucdavis edu 62256054 af2 x3w sh000001 com 4161057 D3O
solutionsbgr com mail protection outlook com 20357989 nqi


sxlvhuan com 70403580 OlB x 160 94 188 253 ahc umn edu 1967507 Kmt
malikexpress com 8039901 InL
morovski stormloader com 17530577 Ppr pkny com 26289167 uSv
adam phys uh edu 16263374 2Fo
d141 245 uoregon edu 49169488 TcU dongfang21 com 82290926 ELL
wireshelf com 6889947 c8H
johnsona1992 tumblr com 90928449 6Z5 okra cs colostate edu 73253672 q7n
jasminsuljevic com 78739052 v4O
perfectintl com 63876897 dsX j0di3 2k7 x piczo com 17191957 qMC
butterflies inmyhead blog tumblr com 40922615 u0f
niceisnice tumblr com 23544541 Mxa cao uah edu 91477956 FhO
cityhauls com 12511795 bjG
sharepoint cahnrs wsu edu 44232869 tMe toyzamas com 42458189 Uk7
largepopcornandcoke tumblr com 56225228 mfF
pomagamypotrzebujacym org 5309653 bnY hotelramaheritage com 15348779 T7J
jeenaisikanaamhai com 79545257 OLU
npcf core test npcf exit test ncsa illinois edu 328469 EO8 tssfatima tumblr com 84093456 I08
aimihuaping vvvqqq com 89092642 t7t
msenc com 047021237 Zsy oulu academia edu 036744993 4oa
bridalonlinestore blogspot com 020985223 6zG
asociatiafurnizorilorcaseiregale ro mail protection outlook com 071105936 eSo cooperatives ucdavis edu 042751625 vr3
sciencedirect com lib proxy fullerton edu 042494856 NH2
teilhardlalouvesc org 021565299 MXW dhcp80fff27f dynamic uiowa edu 084692502 wu9
leozinhodobueiro tumblr com 098608348 AIX
aggieveteranlife com 93277429 594 lacentraleduconvertible com 38097363 pHl
bramptonproud com 73089950 i9h
uudaop2 uud msu edu 55560300 GmK multicapacidades org 26547316 8J6
3 face com 1235313 qR5
chat lesbe abgespritzt com 1853344 QJS cob_intranet cob ohiou edu 75881933 GP7
cpe 65 27 212 54 cinci res rr com 35536222 8Lz
acsprod01 gsu edu 28104093 Uhd 128 8 62 11 umd edu 27549549 Kop
bxg jsjsmgwzx com 45284149 4oC
vlan 45 056 onu edu 84566507 S2k dhcp80ff94b8 dynamic uiowa edu 43812907 ujN
itsmysite xox piczo com 21944 gXM
neutrain org 45456662 p3Q travestitr com 55054503 gxr
strategeweb com 53152195 TcZ
dichvuthietkewebsite org 66046489 Lv1 1643834 rcmir com 96900049 Hkj
mail aarogyamaxillofacial com 81463973 qqh
geekmama tumblr com 26744386 Dbs lefthook trainingsyndicate com 3414360 iJo
dhcp 15 223 sehs lane edu 13060500 F42
collarette worddetector com 2622071 bOp hp2c7 physics upenn edu 96266882 6bz
emporiodisalsa blogspot com 65702281 w0c
m8esi 0808sb com 046811919 ng7 guwuha com 026965523 3MA
pnmib org 099876984 z08
vlsb 2022a 1 berkeley edu 01176043 mrz sex1sex2sex3daaa blog8 fc2 com 014869613 r4l
fangbaishuirongji vvvqqq com 023544209 zkO
webplusmo umh edu 038997350 rjX pacificnode uoregon edu 030898846 l36
commencement indiana edu 080246048 Vj3
plan lp lib unc edu 5106105 pCx ksaal org 22038636 ivC
garyroserealestate com 59589343 KXy
robison phoneroom 251t fdu edu 1821739 UOh klamathbasincrisis com 76021688 1Dq
wujinzhuanyongbaohumo vvvqqq com 13586222 uWT
soberrbia tumblr com 99612053 IUv vassiliyatsev tumblr com 19122039 lK2
bondagefanart tumblr com 58991854 MCt
limoges snes edu 39927098 fbl futureholocenes blog tumblr com 53167893 RbU
hannahklink tumblr com 49307029 8iA
pawsmiciok tumblr com 11218242 5xe kutuzoko fc2web com 62712098 7NU
elinaruka wordpress com 54405666 eQi
lenergia com 7571570 ITA mail rap ucar edu 22219811 0Vv
s295 com 34808382 Jmz
mail thailandphukethotel com 16936789 k54 norubgel com 85550698 dSr
guobiaoribiaomeibiao sssrrr com 51925897 yWX
proquest com bridges searchmobius org 85979480 jKI psychosophie org 90332505 6sp
ee136pc2 ecn purdue edu 2940542 tQ3
european epicurean com 56136422 SjK catcostablog blogspot com 11743359 VUx
x3x kharchou x3x adorabl skyrock com 13857072 dZV
precious hardy skyrock com 088877683 62Q philomathrodeo org 039680487 AQw
egc group org 053953417 JRt
hummus ucsd edu 070780961 Z1Q shuangzufengaoyawuqipentuji vvvqqq com 026783561 qpj
blackbeltdb org 075428317 R7R
saveandsold org 061898356 X6u rubber ducky1 tumblr com 036839504 LQv
69cdi com 036028878 Dt7
musicluver315 blogspot com 65974861 k6j mail laclaseonline com 47014329 T0Q
flipper867 tumblr com 61478433 Nrp
ec2 100 25 89 189 compute 1 amazonaws com 17370999 1go 996198 sanjianglive com 43347686 cJP
robbscustomwoodworking com 85900549 sJx
control2 eng ohio state edu 57712686 glU pubstudent2 as ucsb edu 89598669 3Zp
5dk guilintravel8 com 77879755 BbN
wap 235psb com 39433934 KKK number navicatmac com 91781390 46r
trk tamu edu 5747016 PWA
mail1 bhushansteel org 48358989 RA1 berlinitis com 56914601 sLO
prcls com 29879999 0Uq
nextelmx com 1041215 E7N its urey2226 01 ucsd edu 58487641 my7
85 136 0 177 dyn user ono com 21293655 pwp
dsfactory com 25325425 Fh6 tjsfamilyfuncenter com 39374604 m5f
177828 com 44662337 xuW
dhcp80ff9a1c dynamic uiowa edu 82562252 zRv cksky 1718qq com 37967773 VI2
it wham ad siu edu 16073810 U7k
jiqirenhangjia sssrrr com 75553778 C7h 3i networksketapang blogspot com 55579598 lKF
holdingonastimeflies7 blogspot com 91732295 bkf
dieuhoavietnam com 079871625 mBW lancastermiddleschool com 090269462 COb
operacionyinvacionapercia blogspot com 088942419 3Fd
qd beilong com 076182310 TSA munin lavasoftware org 05772782 G9K
ys 8660813 com 088162370 gqn
washingtonstatefanshop com 041237390 gUN 4049581b2a9e4518 hungblogseo com 099823591 PiT
c2ei blospot com 091328863 a2s
ise usc edu 58182331 yzT e1e6be84c403 19801008 com 1320503 KaH
washington background check publicrecordsguide com 45702620 Ajp
mail vacationgiveawaysclub com 3582437 8lU huhula com 64674144 0rN
minicountryman com 56068733 su1
rock tres roll skyrock com 52375288 MjV ihadm1 ucsd edu 94983750 wZi
fimt ggsipu org 61770093 wHt
spartansuccess msu edu 8833726 FAV nsit dhcp 30 114 bsd uchicago edu 35466559 HJh
tatyandr tumblr com 9175402 6kd
call formula1alltheraces com 3616075 uL5 16656553 en frbiz com 4422725 Ijx
mbctosa org 92063626 MUP
wens wenstoys com 3044654 x41 barbaroi bandcamp com 6550869 czQ
abse366 fau edu 66142743 E1J
testbook com 30532418 d4O hpmsl neu edu 68030237 rcM
0086yc com 58936959 uRp
faszinationlatex com 19035916 1O3 d a z org 70141296 nqd
m1s cristiandevuelta com 16596661 w4o
see dee study tumblr com 28511339 LKZ sun engineering com 31911473 iQQ
dogwhisperertraining chetztogom com 36123939 X4r
clearoranges tumblr com 092861270 Gdz mail vintagehairgallery com 087429294 Q1c
tellyourgodstory com 021491881 zEA
onyxpropertyconsultants com 057793342 WxJ i8myqy marchofhate com 03922195 FAT
houstoncampingsquares com 085317723 iII
dietarium com 091819075 L1A kestrel ucsd edu 047160995 JCL
donnorthupphotography com 028372309 4Ux
lod iula upf edu 24795489 aJr pragatshikshansanstha org 16666983 B5B
why whyn0t tumblr com 56256762 Sb8
d132 mede uic edu 20511215 lIJ sense seas upenn edu 16477596 00W
ciafront com 59983318 8k8
dhcp 155 68 32 150 fandm edu 13927183 KR3 donkilluminati213 tumblr com 3865980 Yj7
vlan 242 099 onu edu 23468086 QPC
advcosmeticsurgery org 13986465 vGg rgs atsec mtbo 001 icdn net rogers com 92193711 5VM
harmonyvenus tumblr com 50335064 n4n
mail dancevalley com 69015474 YDc mysilverlegacy com 52196441 p0m
witchen kitch tumblr com 32135953 od2
sub 72 105 26 myvzw com 89822812 GcX asymptxtes tumblr com 98374777 T8h
shaggymty az com 31345063 cf4
mail simonematteucci com 23871013 8p2 209 193 69 57 mammothnetworks com 89518801 KrQ
129 79 142 180 dhcp bl indiana edu 95855796 nC7
research conductor nd edu 10312646 Cw2 vlan 105 165 onu edu 91300167 3JU
haahumussa2 blogspot com 73615666 k2w
magmap com 98635013 Dv5 1948 big bertha flying model rocket kit model kit org 65769556 SQT
qk3 9500cn com 34492303 vrg
chucheng2010 com websiteoutlook com 088746210 cew wholesalediscounter com 038757689 amL
galaxeast com 082360410 QlH
dku cn academia edu 041854735 ft2 ramzthebookaddict blogspot com 06440028 8sS
circfrontdesk4 lib uic edu 033303138 6Zd
needlink com 028799812 d0Y cavagnero chem wisc edu 092031193 CmV
it fordham edu 08195931 WTo
ecompli bttradespace com 54961967 lNF test sucf suny edu 3869211 wvR
weekendentertainment blogspot com 62408166 SXh
serapsabah com 81473404 K1M client139 68 wireless newpaltz edu 75491244 lAx
rodneyxiong articlealley com 29553448 yZd
206 248 135 102 dsl teksavvy com 39042997 KG7 mrs ps 01 nts umn edu 50418389 LEl
coe229 coe ysu edu 56591736 L7W
domoln com 4471848 Dq4 yn77x hmc benchmarks com 57206017 tdW
sakanaa tumblr com 42517824 dTY
policy96 wcu edu 70308536 C8l d10237wamf00up1 business uconn edu 68692055 wn4
79 76 237 39 dynamic dsl as9105 com 74589576 d9g
pitchperfectmovie com 89103367 HR7 coffeeriver com 98845004 u5u
vlan 232 106 onu edu 3224613 eJ0
daleco hs asc edu 88196235 Qj9 operatorpanelfr com 7545004 Wg2
eleca154 eng auburn edu 79285813 Smm
fbfaceoff vcu edu 56669948 9UR allianceanimation com 83498809 jUj
chi lab8 nurs uic edu 12193160 X3E
dsl net 145m fdu edu 14476181 akE united tees com 78301330 4Vo
jkl nmsu edu 36328933 DOS
virtual gmu edu 096810709 ZyQ commencement uic edu 071438577 8ch
synth ip 81528c0e physics colostate edu 035963673 p9u
treeig com mail protection outlook com 065004417 ajJ jiataobaowenfamenxilie sssrrr com 055793553 5Lb
aluminiosnoa com 048844828 17q
tv cozumpark com 024721580 icy indukksp com 032306012 DyD
gre admissionconsultant com 044182533 0bu
cicahost com 80597277 w9S nis0 ece neu edu 41642989 W64
unicefgala org 90108920 IX5
goto csuchico edu 28242965 ZvR brenhamtexas visitwidget com 71010704 ZvC
jobs fhda edu 99678456 JPd
gccsurrey org 16166472 Dts truthcantbesilenced org 34671743 NVO
ludopatas bandcamp com 64580381 IdG
mx janitorteam com cust b hostedemail com 85441670 2sj grokland org 50804745 LVU
dyn 160 39 255 30 dyn columbia edu 83619555 JIy
0375sc com 69799382 p9M hermes freefucker com 65600669 l8M
ediac org 71448742 ppx
gp1 pop umn edu 2270466 8h7 jn physiology org resources library brandeis edu 78177322 Sds
lsfma com 87577547 lVW
vigilancemartialarts com 90929762 Vv4 fantasyhurler com 59730454 0Oy
mail chem tamu edu 30859214 NiK
virtuallab unc edu 5089538 UzN hiwak tumblr com 52241047 p0E
news missouri edu 35747933 vDv
yelkenbicer com 31229756 9eE nidachonburi com 2379680 eCt
mmsb uchc edu 51671043 PPV
barai com 072106372 qw8 wailuowentongjietou sssrrr com 073105670 V9a
webreakaway tumblr com 055463872 03v
orgsync tjc edu 024453891 TIb spa ph 17 44 spa umn edu 065870933 xfP
degreeaudit fiu edu 083433232 mPB
myanmartracker com mail protection outlook com 067512904 31p dormcrew harvard edu 059747210 5aF
109 sub 70 193 73 myvzw com 088256546 T8g
kesaipbwhs edublogs org 22596581 tj7
14badyears tumblr com 74753071 Slv
x3 poup3y x3 fashion 3x skyrock com 60664755 Mbi
cpe 76 177 119 207 natcky res rr com 16670375 7yk
mx pirrone com 29291718 nNR
vccwlctrl7 129 161 204 net rpi edu 86266889 oFp
benha academia edu 33595869 QyW
68 187 158 78 dhcp stcd mn charter com 84828126 587
cm5048 red mundo r com 89752279 Qtm
it ns3 19 jmu edu 10475508 CiF
3v336 sanjianglive com 38873133 ssI
ghumney com 51572935 KEs
bdb1 cilidra com 92558671 E5z
invitaalislam com 60012226 0cH
cpe 76 188 146 75 neo res rr com 23031762 8wm
killwithme com 8728416 fQr
asianbuyer com 37345603 cyG
jeffreyfqbku frewwebs com 92120913 UAb
cdgem com 73241346 Wfm
blackbird officernd com 81381475 fxy
verseofcelebrities org 1557970 yt2
msntestgroup aforumfree com 59994678 RN1
qinglvzhuangtxu vvvqqq com 16719855 L0f
vlan 203 251 onu edu 87988775 l3Z
kieverchen com 25782572 uoA
anglican church planting com 59010329 vGf
bjzhhr com 93342847 WNC
our hp4050tn1 bu edu 82247994 jie
cascading style sheets qarchive org 70298822 Hdd
schoko0teufel skyrock com 7933439 xAy
dyn59 245 schafer hrz annex bsc nodak edu 64045485 xC8
exterminator escape de softonic com 75890571 t7A
tbleigh tumblr com 45022231 c2R
manet uiuc edu 48543845 oJh
brandyoumarketing com 77279456 Fus
jewelsbay com 30601640 BjV
eliseward com 16995652 Nwn
edialup4 harvard edu 76709447 F7X
pensiontransfer tumblr com 96151361 Wn4
zxowl com 13187280 3yt
stemedux org 47086924 Ffc
fictionalobjects com 18198265 Vp5
pascual com 4638382 7uG
hotel derby lido di jesolo hotels veneto com 1898763 ez8
kandc ticketleap com 56480722 wfC
yuyu167alias blogspot com 53979996 sCJ admin bvfi dev de dd35508 kasserver com 24676793 rEK
babyuggboots yolasite com 31891428 yX6
labweb umkc edu 95828028 x7B lillian44 tumblr com 54381477 kQc
classroom707 geog tamu edu 41655257 1zU
csci5 morningside edu 3993180 nBM abilene uw gw net wisc edu 66208516 mWq
loeschwasser org 21052723 zAD
ywiz9m fanhualiaoning com 89488537 XI3 vlan 102 058 onu edu 61838925 jQM
onlineprojectmanagementhe29283 digiblogbox com 49025358 eib
prplhaze crazy4us com 84320808 fR4 habbowwe smfnew com 40774949 k1B
chodongho com 86906294 yop
mta 76 166 79 145 socal rr com 89390537 iBq popular agencies com 5766626 Fj0
mail fmb oxford com 66927400 Bvm
websp dv3 lac msu edu 16200021 cS9 sourashtra org 46374973 pfg
pandemopolis org 94655664 oUd
oberon ius edu 30137033 Oyn cpe 76 181 29 145 columbus res rr com 58615308 zW2
english drupal ku edu 90697397 gNE
n312 blogspot com 65523427 YxW tit zinette skyrock com 99105849 PPr
mrf5rx sbc865 com 45340941 WGE
garfalk newgrounds com 049338643 Nbw thedavidknightshow com 01457213 WJI
visnetic mailscan for smtp lastdownload com 018521324 vzi
farm stanford edu 078859678 Dru myvalleydelivery org 034254305 hJs
home covid19 org 086784538 bg1
6 14 9 002 esx leaseweb com 092105469 bdD dhcp 128 83 157 87 psy utexas edu 070932897 9f7
ilcanalemeteo com 029404043 jVq
rxpartner com 33509212 Fs9 380270 sanjianglive com 25857809 oNs
skyeve com 48527131 1Pz
mail centrohotelumbria com 13150003 luz ogygianprincess tumblr com 86333974 YFr
hotmailloginguides com 75654846 i79
aguieiragas com 31329395 NJy buyinbulkandsave com 74705399 fpK
keepingay tumblr com 49339014 ZS0
xos7y sanjianglive com 85540211 YMw mailout torchwood org 22767890 SE7
71 10 107 161 dhcp stcd mn charter com 77327378 7Zk
xn xcrs48oksc com 8160203 47N westtexasoffroad homestead com 80089299 6c7
my chc edu 55160460 NJc
gamlavagen22 blogspot com 67545079 SAp hapiz com 10962905 lQN
d39h172 public uconn edu 67907055 mRI
unmhokgm tigblog org 17377002 5Op lifetimelearningsystems com 30225948 WZq
translucent boi tumblr com 94851101 84K
intranet euroglas dl com 66629606 K6m selenastrum kbs msu edu 61477374 L6c
jufreit blog tumblr com 15180516 rbe
87 98 245 254 kimsufi com 6713803 Dm1 allthebestrealestate com 22132499 ecs
frostamphitheater org 29507291 5io
s 169 232 97 107 resnet ucla edu 075850725 nvt voy ngcsu gsu edu 044359983 XPL
konstantin777 mylivepage com 055653427 5Eu
biblestudyforlife com 071678889 IYt 66563 com 012878156 HCM
swt taiwan com 040155848 qnn
posterous dartanion com 016877889 cxD jeanmonmin bloggang com 032204937 RO2
faithjeanne tumblr com 048073544 tQK
journeyisthereward tumblr com 60174352 bQW moonlightbxbyy tumblr com 19196132 FHU
bech 110 8 lib berkeley edu 8857248 GVa
italian citizenship org 45754252 ZKo nextcatalog husson edu 6613820 nEO
fieryfaerie proboards84 com 13362645 Qxi
briannagirl19 tumblr com 36529003 Af3 cpe 74 133 63 217 kya res rr com 32250448 rix
based swordsman tumblr com 21229606 aAQ
zzz bwh harvard edu 3500002 zT2 russiandivingfederation org 35179769 A7I
mosaicinc org 24180023 op8
x 134 84 106 220 ovpr umn edu 35766776 EQz 061244175249 ctinets com 89350513 ERy
inesbridges blogspot com 57541652 qKD
karen moede483 tumblr com 22840793 BhE mpflow org 7063187 Ymi
sbbykhmnmbyvrjmed org 22185867 g1F
sky full of stars tumblr com 80994332 ZsQ n174h192 dhcp oxy edu 76467104 yvE
fullfortuneagritech com 84020902 0Po
admfin ucf edu 18851686 LNG n2h71 dhcp oxy edu 78005270 G38
rjanac com 50272305 S9F
izidia com 91106354 qQ5 indiansales org 95990466 EQz
namishuanghuayou sssrrr com 23273618 Ebv
miloewjqz webbuzzfeed com 097360501 fT3 hartford uconn edu 039413080 cBR
chumley pas rochester edu 038322974 C0T
ordertranscript wisc edu 047791603 pBJ ooichianyou tumblr com 02577980 qsY
d ip 129 15 106 214 lib ou edu 04693995 Foq
zipaigan org 093527408 fDi vrmhubevening0710 eorg eventbrite com 077583580 1UH
fundraising midway uchicago edu 046730988 yF2
itk ilstu edu 12270281 nKQ whatthefrickfracksnickpaddywhack tumblr com 93197942 bo7
arthriticare org 10747130 yau
thisgnatlurksaroundandneverobeys tumblr com 89825750 Uvj alertsmanager dialog com 74960845 xia
talkbeforeyoutake org 74557056 Zyk
thirdcoastpress com 9353577 Hq8 ns1 liberationunleashed com 22518438 Q5U
kelly244 tumblr com 39828915 j66
cndtstw0 cnd nodak edu 29447216 FIu amssc abbloccdn com 97669860 pj4
dhcp 44 35 ucsc edu 968788 WZC
kycha fateback com 25569300 fMa cm144082 red mundo r com 9206994 cqX
corporatewellnessmanagement com 64620936 j9N
sabny4 tumblr com 39206391 pAk x173y088 angelo edu 68064842 u2H
rochellepc com 98105655 vJB
tiredshou tumblr com 67985437 LKg dong penis tumblr com 48293699 c0O
gallery tankeku artgoin com 50932818 Bwb
cityofclaytonga gov mail protection outlook com 36348569 epW b00005qgaz seasonbuy com 49466710 saq
aftss fau edu 18286767 IFd
ns1 charityfinders org 20303225 fax drmseals co uk mail protection outlook com 57169972 U1u
darkheart312 tumblr com 97866901 FIU
dummywithatummy tumblr com 040374495 aEF drinkinginla26 tumblr com 083374451 qZc
resnet154 199 medford tufts edu 053493388 gw0
troutmanpepperhamiltonsanders org 027207719 mAX x virus 13 x skyrock com 050626511 n4C
wkstn197 127 poulton georgetown edu 011896589 Xdi
awendylove blogspot com 054227779 CZd mici asmoz org 066549902 Ine
x94 101 88 dhcp stu umn edu 039871199 kKM
shimukuaicanzhuoyi aoeoo com 12141989 dpq simpsongb com 22461400 FGv
law50 pc 10 lib msu edu 892405 qu1
deathbyarabbit tumblr com 80697069 Rsv blasen gratisbilder ex weiber com 33672277 efr
ezwines com 73614066 VN4
spiderman ece utexas edu 46585007 15B pilavakis org 85668598 CuC
myendnoteweb com ezproxy bu edu 12083503 KVX
welchnet net mail eo outlook com 14906389 196 oneholiday com 74386446 l1Y
kenn_gaither tripod com 56618580 EO3
cpe 76 184 225 100 tx res rr com 74705149 KNt housingsanse housing wisc edu 66639474 nII
hp4050n ath unr edu 40329898 1N2
wood95 011 wood wmich edu 89835084 dTb musicianbsfriend com 29207012 12f
dancadasmeninas blogspot com 23203020 Foh
mizi60 skyrock com 97036273 wRa vlan 22 210 onu edu 16596900 ntB
chiropractic edu 98116683 F9U
my kettering edu 46404627 N4t host 170 97 dhcp pdx edu 25734562 MD1
boundlessfitbrand com 13335892 8Xd
bethesdapress com 39381108 sWr drsodeifi org 89400721 7MA
zontasouthfield org 85817964 n7n
waiqiangzhiganqishigonggongyi vvvqqq com 041183406 WgN wyp2plans org 014682961 XsK
sacs bagages com 017942601 PVb
131 193 248 144 voip uic edu 06453890 PS0 martinisocial com 099213556 i6J
notjustsugar com 068493260 3cN
orthodonticopinion org 095615315 kl5 webmail eckerd org 020188462 9at
artistnews com 04272036 OYm
mesagrafica wordpress com 54899987 kkX mccleankids blogspot com 53893996 Xz1
blame it on my add baby tumblr com 72996313 RNV
host 90 236 31 119 mobileonline telia com 72903048 SpR detektiv detektei com 725680 w1B
granitecountertoptampa com 91873425 Dzd
chiropracticbizacademy com 98522181 jm9 10 80 203 70 nextgentel com 72990244 e6n
afineshow com 50233994 vwn
optimizenow com 65538471 py0 tvadvideos com 35492 fb dbbsrv com 45369877 MFJ
cpe 76 183 14 18 tx res rr com 37113488 sZL
mattgriffo com 91198467 VSW shw joephoto fotopages com 3805895 MLC
networkserver rutgers edu 81820333 DNO
infinityestatelaw com 88050692 wMp yasminpaixao tumblr com 46232594 Yal
marketingplan org 10884738 lBm
diamondsaa com 51769522 5ql fashion knottychic com 16198804 EG3
artecentro com 30684438 6nO
a104 69 71 133 deploy static akamaitechnologies com 69128040 hO0 3pzt4 sanjianglive com 76284642 Pyq
roadto30 org 17345937 Gtk
keiko dental com 5897138 Afy 0tl polpositionracing com 96716845 utR
vlan 136 043 onu edu 60683009 ZDa
property auctions essex org 03037633 ZTN xn alphtte q2a com 026542287 brn
lorenzostravellinks com 075336650 32b
psych pc079 psych unc edu 051778152 MqF pomper sairp rad jhmi edu 039930264 rRK
embrooks stu cofc edu 073048144 nbS
machtoolinc com 071556708 YRo oit198 caes uga edu 040738839 nA3
farmstay co uk p10 mxthunder com 011937900 0PD
new terrificportraitstudio com 38339420 8aq overthrown org 82435745 cUC
dhcp 221 161 candler lib emory edu 19496365 BJA
670459 sanjianglive com 93896723 0at vlan 171 142 onu edu 60957965 Hgl
aaeod ucsf edu 69657629 RXw
gcls memberlodge org 93697200 bU9 sawyerautomotive com 29494157 feI
support worklion psu edu 82145147 oDV
107 144 241 162 res spectrum com 84277236 HGw 50 sub 72 104 149 myvzw com 33963794 rFT
nullmx passcrack com 40033323 xjG
beta elg uncg edu 33854681 87g mandelonline case edu 51244488 pLu
host vpnsubnet 143 dhcp stevens tech edu 3847687 PrO
turnikemedya com 77960704 sgh vsipquangngai com 3687344 rYN
com123 com 91250434 utK
excas ex ad3 ucdavis edu 81070917 4TN nat 168 7 248 195 rice edu 14286481 Ltj
merci de rien skyrock com 76716611 vFK
242 80 202 16 nextgentel com 23872703 Ktf evilmarshmallowcat tumblr com 80673585 Kgb
medicalturf com 17822849 Jja
babykills tumblr com 93418513 3Vt vlan 37 031 onu edu 2959455 dA1
thousandhillsproperties com 57198134 tSb
artfestivalbethel org 057043894 0ph ip 134 53 48 47 dhcp muohio edu 022949703 PAz
firebird unh edu 075647300 BHt
suicidalchanges livejournal com 029452943 7Ec newmexiconewfs com 032670023 yuE
hotelsecretdeparis com 020565 ys0
louisianabusiness com 057888293 Fkv hyjy com 045293419 VsR
tfs dhcp 083 tamu edu 02627543 Vra
strength eri ucsb edu 78027716 42L terryc1uk blogspot com 90674311 AwZ
thinkingondifference wordpress com 18436842 9I5
libertyhotdogs com 56577822 gW6 n058152137115 netvigator com 72096414 2VT
a0x happylittlestampers com 550848 78k
cd46af057eacf017 sindmusi org 36560049 ghv mayoramaya tumblr com 26166740 yub
mail trafiler com 2448667 5FT
iifftampa com 43119565 I26 mail sobhonduras org 94912794 ELM
lisbonne thalasso line com 99145640 Fy7
ipoe071 as2 helpteh com 37420220 CQg 128 193 215 185 vet oregonstate edu 71039560 nPy
vernilla others blogspot com 60553656 zx7
opportunidad com 59578379 xun term219pc1 ecn purdue edu 43987905 pEP
lalp georgetown edu 25794707 1tB
villaniautomobili com 71835063 0TM 024 196 174 030 res spectrum com 73263459 v2p
counseling kzoo edu 4101597 fVa
madun03 blogspot com 78082419 O9p acbiomed com 60303825 LUg
cbs aftol prd oit umn edu 98217150 1cg
roboguide ri cmu edu 87639426 8U3 listentree media mit edu 70140460 PVi
super newgrounds com 49526399 Hna
massachusettswellness org 085243560 Ryb weboscopy com 036265461 vAp
guerrillacapital com 084101684 ftA
mlopro org 027439118 hAD azyeshiva org 094023756 EAV
herb shop com 055376231 otd
flexistentialist org 081375109 4Zs tthhen tumblr com 079560367 T63
fightforlifeinc org 055245255 olp
qichediandumenshijian vvvqqq com 29058891 7A8 gallery calvin edu 15862596 ZY3
kscservices com 40824116 rPR
domingo online tumblr com 37410781 cc9 dc816 org 69487717 55r
commencement uconn edu 22147454 df4
resnet 32 157 resnet ucsb edu 36881725 gp2 wybostonlakeshotel com 71872191 QvD
ustravelconnection com 36573588 SIK
lesbipic com 27236764 24R fb3read org 52219352 CgA
gw12 standby 144 118 86 254 noc drexel edu 61354563 56V
guri2 articlealley com 66280036 SLY jingdiananlixiliechanpin vvvqqq com 72866794 m6S
ofaffa04 tumblr com 28734923 QF4
be by com 39131584 Jdo torocap com mail protection outlook com 22386874 bgv
05429f97 skybroadband com 56692601 7rb
mail 1choicechiro com 89954025 suu alumni uwplatt edu 50998027 cMx
changelibrary 100mlives org 11147146 yyK
janzen sas upenn edu 16488110 FGL weird honey bee tumblr com 32754727 4lx
nvzablink com 93878103 Zus
217 216 220 184 dyn user ono com 679698 QRC mta 72 134 5 83 socal rr com 86285350 esY
ieul academia edu 83979618 8Z4
www92 szzc365 com 0191844 ZEm realestateatbluemountain com 055875334 Gpt
dd24830 kasserver com 07306921 U6m
thecolorist blogspot com 028397141 uTy infoeducrb blogspot com 010779470 Dif
wilkesbarre psu edu 078576999 lnb
mojacpa com 053717447 KMU 6a90e9b956cb424695d9fd975a1c67 pamx1 hotmail com 068239292 BdI
cherokeeheritagetrail org 091655095 nZ3
bythedarkofthemoon wordpress com 59191051 88m syxdxzx com 25900307 jX1
arhu server switch umd edu 29367549 xmR
wkstn105 150 henle georgetown edu 73727950 bW9 mail managementjournal org 12439177 Q2l
didine fland skyrock com 7719849 Xe3
platinumvisions com 42592267 VkJ precisepilotpens blogspot com 54785231 O1F
solly not solomon tumblr com 2044541 xwu
mta 98 146 67 207 socal rr com 73452738 FbV gimelbrantlab med harvard edu 26328258 UID
chappystaproom com 34345545 nxi
dumpstermgmt cc uga edu 25112439 YmN dezhou 99cfw com 51769475 ZWD
dailymusicworld official tumblr com 89793193 XW8
dhcp80ff3744 dynamic uiowa edu 35014556 WNw peachy em blogspot com 2769501 Leq
ip 128 239 46 21 v4 wm edu 38395238 oGv
sitespromoter com 81445903 w9r justdreamingofcupcakesandlove tumblr com 53867734 HEP
violaineb eklablog com 77985680 dft
art estetica com 34539911 Den buyg0rewhore blog tumblr com 27136004 EpN
cancer control wikidot com 24000019 qmJ
fartfilms org 7009381 FbB h9oyc ttrjcf8 com 3232655 ffV
mojo austincc edu 63177768 dI2
studentek com 021128321 crI identityv stage com 054470924 0N7
a23 51 62 223 deploy static akamaitechnologies com 097855986 1y0
psych2017 tumblr com 051134621 cVc thisgirlhasonlyouinhermind tumblr com 010892965 6dV
thecurrencyexperts com 076411316 uBW
targetbabyregistary com 038879483 Epc sfethers tumblr com 021945574 Itk
tvfandomgifs tumblr com 036296264 apk
gsp173 tumblr com 17343587 8vD jaanuary 19th skyrock com 82191560 s2o
dns3 cse tamu edu 45254475 uue
medialaw seattleu edu 49790130 bAA oclcgw net columbia edu 8262924 hqG
byya525 tumblr com 38374291 jnK
1 zippo lighter org 13020211 Ij7 liferescue24 com 40387516 Mes
75 inch mount wall mount org 77074700 NJs
annakrahel dentysta stomatolog com 95727769 Zou america edu 20538952 jD6
657 150 ap fm uic edu 52552875 LT6
uclansuapo tumblr com 91184901 fEH owl excelsior edu 33477966 Hnm
www101domain com 87615438 0jk
buxiugangluodiyijiapeijian vvvqqq com 98142680 4LI streamertyer com 13081901 pNn
iise orgs wvu edu 90103206 kkG
wsc 209 239 196 192 worcester edu 95912544 bcx 024 180 141 006 res spectrum com 61035227 OAm
cpe 24 29 88 203 nycap res rr com 30860533 sF1
lanzhou kuyiso com 53994398 rsG tezmess blog tumblr com 21526047 WyN
purelandofiowa org 45956871 TZQ
biblicalcapitalism com 76634614 DQp sahler werbung com 97331463 eeJ
researchdevelopment vpr virginia edu 43059369 xBh
abright night blogfa com 078035948 B8l 140 182 173 68 dhcp bl indiana edu 089515962 4Bn
trug3 eventbrite com 010331801 5Ek
book_of_daniel bluerider com 084709197 zxg venus itl cs kent edu 012602277 h6r
standwithtexaswomen blog tumblr com 038610004 iDP
mirthalasalinas com 069201324 hvW m12n com 068421854 aDO
uexplore utah edu 060016280 X7d
vfw8752 org 64452768 og8 gongyi rythmandpages com 51979420 joP
chistesparaelrato blogspot com 1051168 dDh
courtneyyjeean tumblr com 86520863 ytS the angel star tumblr com 70572235 hZH
more4agents org 45859649 mIn
agrifood upc edu 94757855 49E jydarun com 73115165 7qD
444info com 60295261 dmv
longshunmiaomu dnxfc com 84225513 RVX ambrosiaonthesquare com 78025129 NcS
retina med harvard edu 26092319 gvH
violenciadegenerosevilla blogspot com 83999124 k6k adirondackfamilyactivities org 84868294 e2M
mail gajillions com 63728447 NSU
romyim tumblr com 77328459 btr fitnessctr 075t fdu edu 44115478 3yE
sdandl com 94440218 J0J
kxlk4 sanjianglive com 39303233 oGm n9h189 dhcp oxy edu 78679009 Z0I
trilobyte ucr edu 73378908 UfJ
78 66 75 26 no174 digitaltv telia com 27472802 VPn jbrodnickiknits blogspot com 66198904 2Xm
fedlawclerks org 89977873 k2R
huntsville factoring companies rjbstudio com 14777910 GM4 scalablearchitecture com 30291244 aIS
americandrugtest com mail protection outlook com 75070113 s5L
truccacaboudin skyrock com 99778718 FQA boz style com 63417994 6Sd
68 189 218 154 dhcp ftwo tx charter com 14972808 cyt
dullesva catholicschoolhouse com 29480017 vL3 vlan 58 079 onu edu 36260608 hj7
iamxla2tina skyrock com 31292772 IFf
rrcs 147 0 34 41 central biz rr com 22532305 aNb wbfejm fanhualiaoning com 32027825 lva
vlan 197 079 onu edu 30728745 E5o
fall ohne netz tumblr com 95710997 LxJ captinofthecoolkids tumblr com 7127180 e8S
brightnightflower tumblr com 21929305 Ytw
nationalrepaircenter com 20776433 18I titlerecordresearch com 36677254 NjQ
bouncecalifornia com 21810719 64D
sportclubnavigator com 36632497 QTB analytics abz reporting com 18431657 hTb
domain china com 44509888 fAV
cumonbi com 85185105 piP taxi valencia com 45776098 Bug
skylo org 94211930 GF0
61 c7 3ea9 ip4 static sl reverse com 97368798 64d oktwister com 22371564 uCP
watchingthetimes org 87363401 odh
mta 76 176 243 240 san rr com 32008275 GNB luanhuashebei sssrrr com 56559561 m2h
bepartofus com 4266186 yjO
californiajuggling com 090215419 bfs taiku com 081890862 4OE
hksc fyznj com 075190753 8YX
firexint com 064282663 NYx bimp uconn edu 012180170 z5X
cpe 24 208 31 202 new res rr com 079690612 bQS
tomelon tumblr com 033411370 Wi1 robertsongallery wordpress com 055214367 ttj
tokisoup tumblr com 020130828 6JU
hipbrace com 25221166 rp5 croscillcomforter com 94525969 EAz
dhblattner org 11650196 s2F
autoren allianz org 90700744 3es xg caihao com 36719985 tVz
proptech cioreview com 54224219 vy6
loremitic tumblr com 50774687 ayl prxy4 ursus maine edu 5972181 V3P
askaracanakliyat com 51306211 8kb
solar 2 wpi edu 64343326 DTJ grayson dreamhost com 44135131 Dmk
ilr8zoy ylaob com 23145728 5PX
chm sooslab 2 princeton edu 70070575 TMv casitasdemunecasartesanales blogspot com 24539561 oOd
thecoldequations blogspot com 82173753 2kp
maurofarmpotica org 34508656 b5c noonpost com 81966110 712
deeppeacebodyworks com 56662266 HC6
asepalermo blogspot com 73483702 pqj qqearth com 44578593 5Dw
tzjjqy com 46737027 qKd
pengobatanpenyakitasamuraat blogspot com 78501708 1TL charmingmissy ikevindurantshoes com 38519340 Ium
dm6y9 sanjianglive com 94411733 xDN
orbitless com 28087887 rHK rec2014 iit edu 18802346 48Q
olli unl edu 78358701 hXr
asurt skyrock com 062505470 25x gcphotography3 wordpress com 020750992 fnj
nationalchefswear com 080011087 wYY
popotum tumblr com 064089538 ffw polaris444 tumblr com 028501072 UmF
referencedusite sosblog com 074504836 qSN
juliastamman com 085706423 daE paramusmall com 098113565 BEv
lab5 65 eng utah edu 011798638 Oz8
ohioamishcountry org 28178763 UZs xfcc org 80040984 XDe
bripelcher tumblr com 43357983 X6N
h 129 22 9 117 cwru edu 41984303 ugO mail humane update com 25476321 f7I
mail coachescarefund org 2233795 bTu
bofenfuyongchanpin vvvqqq com 72907815 3IZ poetisadameianoite blogspot com 93501075 qNd
part xazjsj com 70170238 ZCJ
foremost sales org 55814829 ins live cam044 com 42510743 kyM
stpeterssoftware org 68077508 oP3
kkellogg scripts mit edu 94828575 Dl0 tres lesbien tumblr com 16646933 39G
suriya resort negombo hotels com 96440839 p3H
americanbiomedical com 91348344 SFG fergou tumblr com 37354428 6rg
host217 43 117 87 range217 43 btcentralplus com 31183012 nzs
xx adrien77 xx skyrock com 40247284 EBj brightdynamic com 35614208 PmW
digicom47 blogspot com 46296396 0RS
bluewolfy101 tumblr com 60677093 7yj sinem angun tumblr com 66048542 Bj7
xx pauliin35 skyrock com 84783703 Va5
156 56 137 132 dhcp bl indiana edu 89850115 3V7 voidhawk cat pdx edu 55854304 ZHh
barracuda math harvard edu 62433111 rSi
journ 85 umd edu 057191220 med gillescoullet com 090157736 H5u
azsafari com 09984057 eWy
awinnter08 newsvine com 096257352 Liv relaxcupcakes deactivated201507 tumblr com 039244323 6EP
vpn1 dhcp94 bu edu 085696892 87X
m h w com 077774165 s51 schiefferschool tcu edu 033753530 MPK
calltargets com 032064064 ks8
formentorensaimadas com 52523070 lZK phenogen ucdenver edu 33492592 g0J
florence4fl 244m fdu edu 68438958 77o
onecrazymother com 99660033 GAG mr tassy bear tumblr com 59585225 y0S
langley dhcp 234 244 uchicago edu 53674833 Nhj
studentaffairs int5 v30 net unc edu 51259477 kSl static 69 50 245 191 nephosdns com 1550050 qJY
uniworldtechnologies com 10881721 pmv
wellscanning com 59552087 k75 ebaydev docenthost com 46778514 B7r
rhyhorn cs uchicago edu 83867538 cPT
mail 567chevclub com 47815010 w56 melisha971 skyrock com 61110682 6Qs
virtualmining org 57125840 7Xo
psychogeometrics org 11272065 1SE queen jude tumblr com 74875886 MVQ
sjaavaag com 89657165 njl
d149 67 93 143 col wideopenwest com 30509972 SN9 mx ammit com 48212629 mWY
tonytk97 tumblr com 81670137 nCL
century21jackassociates com 50544885 x4U host 159 178 205 185 hsc xlate ufl edu 35314792 9MF
prijavaporeza com 15259351 s5Y
alurz com 55547980 zNf transcendtechgroup com 51072013 3nv
kjandco com 74985566 kTG
inivix com 046450854 Uwx parthood com 026430470 KPs
edmontonfrailscale org 076781640 lah
casan com 015650732 LUz tiwe org 055997072 LUh
mobilier maison com 021885159 gsy
portal hosp uky edu 07151759 rih l21b tfixrpairs com 0719374 4GV
pasco wednet edu 035153562 dmn
m811 org 32149617 pFY anunforeseenadventure blogspot com 79468055 32Q
80 225 78 157 dynamic dial as9105 com 88069060 VTp
jdivaexpress com 73823626 pWN redbussecondarydns anstaltleasing com 40848072 1PL
hockeymineurvictoriaville com 8495654 26G
oneforlove org 36326683 uST muslimstudies msu edu 36685915 1HY
eastweb ualr edu 28381379 Nr4
crazy light com 75401978 fWo vestas astro berkeley edu 74022383 ope
sanwk 5 rutgers edu 29072640 yHo
com proxy uwec edu 28483360 5ww kongling2006 blogspot com 39267580 va9
moser23 1annuaire com 8322687 GdB
mail trickiknow com 72385338 0EY alizstudio com 125082 QA0
cucweb chapman edu 2964792 0WY
nodem msfc vl280 bio nsb network 183 1 ucsd edu 97710125 Nc6 n2 57 132 dhcp drexel edu 12263410 W25
deixeamare levar tumblr com 94652874 5Pm
i57j5 sanjianglive com 35338327 zP4 lubwsvson01 1 ttuhsc edu 90131964 znW
mx sarikaya org 47972862 8tf
alturasartcenter com 34673032 4Qe popgoestheclassroom com 13711662 nIT
muggles ad uky edu 57619138 nTU
apoereceptors anat uic edu 068317390 cLy sislibirhava tumblr com 075130270 duB
ibhztaos tumblr com 062001016 pVd
ex7 sharafchem com 041825284 AKj arquidromosantiago blogspot com 069731745 1kK
causeylab uaa alaska edu 029219017 fX8
vlan 142 094 onu edu 018865079 DWU njzlx com 046905218 Y7t
kakyou 5imybbs com 098654615 QQ4
mountkailashtrips com 47822160 jvV drvnkenpastels tumblr com 14720315 hi4
dakotaassetservices com 53745238 tPg
snowyonline com 61200107 yfa cpe 70 113 41 74 austin res rr com 63420440 hZc
sbupload com 11854034 twq
m2mbar8def9 blogspot com 17593000 piF 068 191 159 122 res spectrum com 7148416 gfq
fronkolonk tumblr com 21330921 yeS
fwtsystems it mail protection outlook com 72177923 Bgu briye org 12154111 WoY
lomejorde org 82787698 BUD
wakomics blogspot com 76352788 tg5 cmll01 fl msstate edu 40940150 ZmE
is isa01 01 sunydutchess edu 15564184 91E
ptr vmc1 library northwestern edu 69210857 T8Z dragxngal tumblr com 60065019 vgm
thuleindumentaria blogspot com 65715617 HOJ
theo fashion skyrock com 36714433 oqf sustothaki com 31172537 xEQ
jos anglican org 73984298 CnA
cloud035 cci drexel edu 45104337 ikL lifeofillusions tumblr com 46853467 jE9
daofengtongtufubu vvvqqq com 28767174 YU6
naruto mugen malavida com 40625987 ESt bcouch com 29970039 6gQ
pinka chan deactivated20120121 tumblr com 50016771 dox
more info31949 ivasdesign com 081114795 zoX scottsweekendcooking blogspot com 063212783 t8K
webofknowledge com libdata lib ua edu 033712074 6Re
omgnonbinaryartist tumblr com 043634242 W6N galparket com 032527566 juW
divineappetitco com 063806353 x6c
oed server1 apl washington edu 039619706 GHd contactjesuschrist com 063926235 ysM
tammyngn wordpress com 087368698 RVO
yascob99 wordpress com 20767275 btq uexternado com 468498 x3v
ce3 dyn 203 ce utexas edu 68549526 oYk
vlan 164 108 onu edu 90765431 ndL ptb277d 1 ipst gatech edu 69145598 Lbt
without ttjgj com 69182736 33w
lin45321 hisupplier com 49306618 HI8 traininggrants peds wustl edu 14919415 dhb
theredrabbit org 29205407 ixW
tickets uwp edu 52797652 cNu lakelanduniversity org 81655507 qlF
av suevia com 25804826 4If
axelbaudendistel com 67975279 SAH cpe 76 176 116 114 san res rr com 94370125 W1H
planesigualdad com 15198331 At0
durgapurtv com 36226435 ppw ashampoo cover studio 2 ashampoo gmbh co kg qarchive org 62512264 Liv
centridium com 46768619 DAo
a23 222 119 140 deploy static akamaitechnologies com 29001130 S14 manmadereligion com 26726170 kfx
artgallery tufts edu 36724836 8HS
mlt218 chapman edu 66352660 upS adx track srv com 82322142 Wo8
whitebuffalotruckee com 22842592 Ecp
bookaholicsnigltd com 30225834 QcL electronicpost com 16459103 gwl
gamersisland com 30355628 qf0
porn mom sex room jasminslive com 069372686 U5P art 8 po206 radford edu 050372487 Rmu
by2 com 056431469 1ae
theheartoforganizing com 087197128 VrC saltware app mail protection outlook com 024114888 dnK
gc3f uoregon edu 043760073 XUE
mx trecerie org cust a hostedemail com 066595946 UfO restaurantperson org 063390330 ZQm
joseluisdelamata com 072661491 MMV
netappefficientit com 47365217 xkH teenagefaceperfection tumblr com 37129220 JIB
hotel la capitainerie loire valley hotels com 79352809 tV1
ns1 adalis org 15240810 kKo miotti org 81564313 LqA
skmsport com 83736209 zBl
galaxiaproductions com 52839780 7yW stmlv org 85470018 9EJ
nihao usa com 32167623 D8e
softchantelle tumblr com 96000501 Rsy paris hotel pavillonbastille com 99714805 7jf
eyrz com 80818357 GXa
univdhaka edu 92642086 8OK cpe 23 243 56 191 socal res rr com 37235711 sw8
seegna com 65727113 Rhx
tijekuha angelfire com 21771575 wxD ashlypa tripod com 86914243 YY2
algogaming com 15124229 skZ
cacespe blogspot com 48718530 Mxf afcpeachieve org 91796562 U5D
maybebitch blog blog tumblr com 15114552 1L2
a4 cs umb edu 64756539 rCH chanceaddca frewwebs com 16403643 BOX
heradesign com 84457496 YQK
songerinstitute org 7002446 sml h obochan tumblr com 92001224 Z1D
greenbkstr com 35861102 zVy
reedwilsoncase com 044504329 eCq jsjeunestyliste skyrock com 048819791 Oxb
idyllwood com 024416736 QAO
sibspace org 045075891 mwp tartancard sinclair edu 031063235 Fpx
view e weforum org 099302308 hLL
cheyennetozer5 tripod com 026512851 g9U ds05 seas upenn edu 084261757 poU
merc kpmonline com 036952578 fqA
jadid rap tanjawi skyrock com 34298934 htx might posco web com 67716299 Kb7
search epnet com turing library northwestern edu 29634222 iGU
ecoemergence org 19291152 O12 mohanish office med unc edu 57675659 vDW
tirrxos angelfire com 31280498 aOp
12274 kt379 com 8648294 DZD denverrpost com 50910102 Xi3
vm cd mc 127 virtual illinois edu 15139041 chv
cts if4063sol01 uits iu edu 27494270 gGi tb0104533 betteruniverse com 60849517 THP
seongawur wordpress com 88469578 6SK
juqili com 69905906 tY4 mediasite sdsu edu 72217675 qKN
mkt3853 com 76138039 tcj
metodotetragramadeviagemastral blogspot com 74981544 LSm westcorkbeekeepersassociation com 39493293 uVc
josietapunto blogspot com 61064064 NOF
jixiejizuoduanban sssrrr com 22399292 kJ9 generationx meilleurforum com 97584639 wV4
beyondplotshitthunderdome tumblr com 56665844 JIW
jurucesesa yolasite com 16801765 V9V haljo blogspot com 90945961 Sqh
u6oqds hzybhotel com 60306993 2wc
tornrose com 16464442 m6z 1r pywasw com 41363192 3Hn
htjxgs com 22524385 ebV
celloffers com 083234831 WX5 dillonle21 tumblr com 046369975 ghc
gemlouise75 wordpress com 017607149 TxE
190 sub 166 144 22 myvzw com 058788199 hQp redbusprimarydns visiting com 083436426 LsO
webfocus ucop edu 024323782 TQK
ec5887a315 migliorepoker com 085555744 cME vlsi cs ucf edu 065991444 7ZI
206 sub 70 193 73 myvzw com 066300220 H6t
scjxsy com dedicatedornot com 47321678 aN3 research2 sw 1 ndsu nodak edu 89071278 dzY
caserver1a gallaudet edu 69347042 5v7
kodakanto tumblr com 13574604 uYE truth will come out blog tumblr com 25801122 42P
x beauty peoplee skyrock com 86955716 oCT
che2502 tripod com 15212363 SyX goldmakermarketing org 89542098 ncD
mail wallrocks com 14129972 xGb
navytatoos com 90884407 DYo ec2 13 211 21 158 ap southeast 2 compute amazonaws com 11766860 qg1
ip163 10 tccw wku edu 17489349 LvI
joywithme com 33646969 DCj broadbar com 4757664 hM5
lebaker com 61934022 HQP
ip 134 53 53 104 dhcp muohio edu 83949954 35h theplacetostand org 16310092 ygH
casper jun alaska edu 32723980 SxF
tilebazaar com 40697921 gkk hemonc ucsf edu 11147582 8Mr
ridesbikerental com 81709821 0IM
launchpad business utah edu 65656537 ARA starstrukk lover blog tumblr com 29956914 Wm8
edshare org 21155010 z0C
counselingandassessment org 74002939 4BD minerva cea ndsu nodak edu 4979824 wtX
diaodingbankouban vvvqqq com 46365176 hGo
snowflakemaker tumblr com 01773108 4Z1 interactivequran com 059125949 ePe
c sevenmir com 077477977 gZn
grs3 thegrs com 027453082 rCA loganalexandramusic com 062192114 U57
metroidlibros blogspot com 017170146 uda
classrooms syr edu 03473347 YZq tetris 1001jocuri com 090537844 oPq
icreativity tumblr com 032610672 85y
pathug com 4712487 Z5j national100k com 51424624 qQH
timebasedscoring org 20858808 2lG
smartestwomen com 21374690 7RO diaosun com 57122606 4n1
protenium org 23418135 QUC
ptts admin12 tamu edu 42046961 Hpv web01 kapiolani hawaii edu 67610089 wFo
camdenreid com 65708928 LIh
tonnybertiny skyrock com 61561251 asQ endo hp22 bsd uchicago edu 88333794 LjD
attur askdefine com 93007020 tYW
nhmbc org 77281641 FXd president astate edu 10963450 iU1
movies bg org 49314144 LUy
sur m537 bsd uchicago edu 39170513 dOz waylonzrqyn digiblogbox com 96051958 Iq0
sellingstbernard com 30407266 znL
catalog westfield ma edu 71261186 Zxq greenguides arizona edu 40062839 5RM
dyn 160 39 16 162 dyn columbia edu 74831 LzA
opethandmelinda tumblr com 14799992 JgP formsandsurfaces com 51169833 v4k
apnplastics com 34532609 I5l
elec76 eng auburn edu 57372615 aB3 47 33 122 173 dhcp rvsd ca charter com 286019 ofF
ww5 vstudies org 37741548 8KK
poppy obrl uiowa edu 013232754 CDh squ153 098 und nodak edu 052217476 2rL
bprc dhcp 171 mps ohio state edu 077743948 UX6
aminata niikiita skyrock com 092774595 cCW smartassfish com 010674605 mNG
imanper galeon com 078590516 o5U
johndeereexpo com 032360744 52F e6417d16e3c2e41ed6 betelgeize org 094309175 gPl
earlylearningmultnomah org 025246362 THs
nadiasyanadia blogspot com 50370940 EEk vipasteleira tumblr com 46265746 Eyf
host 195 211 dhcp pdx edu 22664713 fse
brittanybaize blogspot com 26666380 M1h troyrich com 97349674 V40
sbaex2010cas1 bus miami edu 6699484 k4H
appvirt snip pub andrew local cmu edu 558306 dnZ ezoid com 22679557 iZs
loanyou wordpress com 75371851 e6a
ns auth2 hampshire edu 20314000 Wq7 cs groot01 cs umn edu 73241587 OFw
runseeingberlin com 49662193 YEg
lighthousehospital org 10273382 wAB solutions qa kent edu 56846880 WUL
mylession org 40482794 4bo
seotraininginstitutesindelhi blogspot com 45297324 4o0 68 188 92 36 dhcp stls mo charter com 40577700 3P8
cts dhcp 141 068 uchicago edu 67372315 ajS
ip182 67 outside westmont edu 95113662 mg5 avemaria4u com 9552978 kKZ
kaykeeton com mail protection outlook com 8469471 hdN
neumann microbio ucla edu 21108622 cW3 lab8 27 eng utah edu 50028155 PF3
17rock com 87134178 Eqd
cooperativefarmer com 61274645 SGf polymathinc com 29003244 47h
picol cahnrs wsu edu 99956162 6oX